PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G76350.1
Common NameF15M4.15, NLP5, T23E18.27
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Nin-like
Protein Properties Length: 808aa    MW: 90684.1 Da    PI: 6.1268
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G76350.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK93.71.3e-29546597152
       RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                  aek+i+l++l++yF++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  AT1G76350.1 546 AEKNITLDVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGIQRWPSRKIKKV 597
                  589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.097536617IPR003035RWP-RK domain
PfamPF020421.2E-25549597IPR003035RWP-RK domain
SuperFamilySSF542771.3E-22700798No hitNo description
SMARTSM006661.7E-24710793IPR000270PB1 domain
PROSITE profilePS5174527.111710793IPR000270PB1 domain
PfamPF005641.7E-17711791IPR000270PB1 domain
CDDcd064073.90E-36711787No hitNo description
Gene3DG3DSA:3.10.20.2401.5E-19711790No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000191anatomysynergid
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 808 aa     Download sequence    Send to blast
MENNSLPMDP AMDSSFMDGL LLEGCWLETT DASEFLNFSP STSVAPFDPS SFMWSPTQDT  60
SNSLSQMYGQ DCPERSSLED QNQGRDLSTF NRRWWIGPSG HHGFSVMERL VQAVTHIKDF  120
TSERGSLIQL WVPVDRGGKR VLTTKEQPFS HDPMCQRLAH YREISENYQF STEQEDSDSS  180
SRDLVGLPGR VFLGKVPEWT PDVRFFKNEE YPRVQHAQDC DVRGTLAIPV FEQGSQICLG  240
VIEVVMTTQM VKLSPDLESI CRALQAVDLR STEIPIPPSL KGPDFSYQAA LPEIRNLLRC  300
ACETHKLPLA QTWVSCLKQS KTGCRHNDEN YIHCVSTIDD ACYVGDPTVR EFHEACSEHH  360
LLKGQGVVGE AFLTNGPCFS SDVSSYKKSE YPLSHHATMF GLHGTVAIRL RCIHTGSVDF  420
VLEFFLPKNC RDIEEQRKML NALSTIMAHV PRSLRTVTQK ELEEEGDSMV SEVIEKGVTL  480
PKIENTTEVH QSISTPQNVG LVFDGGTTEM GELGSEYGKG VSVNENNTFS SASGFNRVTE  540
KKRTKAEKNI TLDVLRQYFA GSLKDAAKSI GVCPTTLKRI CRQHGIQRWP SRKIKKVGHS  600
LQKIQRVIDS VEGVSGHHLP IGSFYASFPN LAASPEASSL QQQSKITTFL SYSHSPPAKS  660
PGSSCSHSSS CSSETQVIKE DPTDKTRLVS RSFKETQTTH LSPSSQEDDF LRVKVSYEEE  720
KIRFKMRNSH RLKDLLWEIA KRFSIEDVSR YDLKYLDEDN EWVLLRCDDD VEECVDVCRS  780
FPGQTIKLLL QLSSSYLPER SSVSGCLS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.483790.0flower| leaf| root| silique| vegetative tissue
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1864957680.0
Genevisible259888_at0.0
Expression AtlasAT1G76350-
AtGenExpressAT1G76350-
ATTED-IIAT1G76350-
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G76350.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G76350
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4935370.0AB493537.1 Arabidopsis thaliana At1g76350 mRNA for hypothetical protein, partial cds, clone: RAAt1g76350.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_177761.10.0nodule inception protein-like protein 5
SwissprotQ9SFW80.0NLP5_ARATH; Protein NLP5
TrEMBLD7KTC40.0D7KTC4_ARALL; RWP-RK domain-containing protein
STRINGAT1G76350.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34612663
Representative plantOGRP2991697
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Scheible WR, et al.
    Genome-wide reprogramming of primary and secondary metabolism, protein synthesis, cellular growth processes, and the regulatory infrastructure of Arabidopsis in response to nitrogen.
    Plant Physiol., 2004. 136(1): p. 2483-99
    [PMID:15375205]
  3. Schauser L,Wieloch W,Stougaard J
    Evolution of NIN-like proteins in Arabidopsis, rice, and Lotus japonicus.
    J. Mol. Evol., 2005. 60(2): p. 229-37
    [PMID:15785851]
  4. Kong H, et al.
    Patterns of gene duplication in the plant SKP1 gene family in angiosperms: evidence for multiple mechanisms of rapid gene birth.
    Plant J., 2007. 50(5): p. 873-85
    [PMID:17470057]
  5. Wuest SE, et al.
    Arabidopsis female gametophyte gene expression map reveals similarities between plant and animal gametes.
    Curr. Biol., 2010. 20(6): p. 506-12
    [PMID:20226671]
  6. Hanada K, et al.
    Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana.
    Mol. Biol. Evol., 2011. 28(1): p. 377-82
    [PMID:20736450]